• Home
  • About
  • Contact
  • Login
Upgrade
Oggonomics
Advertisement
  • Investing
    AOL Is Back (and Public Again)!

    AOL Is Back (and Public Again)!

    Are 13% Dividend Yields in Mortgage REITs Safe for Retirees?

    Are AT&T and Verizon Signaling Dividend Mortality?

    BofA Sees 4 Stocks to Sell Immediately!

    Wall Street’s Worry: Will Nike’s Turnaround Ever Make the Turn?

    Micron Analysts Raise Their Price Targets to the Moon

    Micron Analysts Raise Their Price Targets to the Moon

    4 Value Stocks That Could Rally 50% Into 2027

    Why Wall Street Finally Likes Target Again!

    Why Wall Street Finally Likes Target Again!

    11 Stocks & Funds That Already Own SpaceX Shares Pre-IPO

    SpaceX Options & Leveraged ETF Conundrum: The Tail Can Wag the Dog!

  • Economy

    Will the Fed Dare Hike Rates This Much? Or Even Worse?

    Why Gold & Silver Keep Crashing (& When It Stops!)

    Trump’s H-1B Visa Plan Gets Tossed; Math & Stats Need a Deeper Dive

    The $25 Minimum Wage Bill: A Path to Even More Drastic Inflation

    The U.S. Sovereign Wealth Fund That Could Be (and What It Could Have Been!)

    Wall Street’s 2026 S&P 500 Forecast Sees 11% Gains!

    Why Goldman Sachs Sees 2026 as Prime Time for Strategic investors

    THE TOP INVESTING THEMES OF 2026… According to A.I.

    Strategic to Secular: Bold 10-Year Goldilocks Outlook for Stocks from Goldman Sachs

  • Personal Finance
    AOL Is Back (and Public Again)!

    AOL Is Back (and Public Again)!

    Will the Fed Dare Hike Rates This Much? Or Even Worse?

    Why Gold & Silver Keep Crashing (& When It Stops!)

    Timeless Warren Buffett Lessons for Long-Term Investors

    What a Fully Depleted Social Security Fund REALLY Means for Your Retirement

    Trump’s H-1B Visa Plan Gets Tossed; Math & Stats Need a Deeper Dive

    The $25 Minimum Wage Bill: A Path to Even More Drastic Inflation

    8 Strategic stocks to Buy for Strong Gains in 2026

    Financial Giant Sees Path to $6,000 Gold, and Maybe $4,000+ Equilibrium

  • Retirement

    Are 13% Dividend Yields in Mortgage REITs Safe for Retirees?

    Timeless Warren Buffett Lessons for Long-Term Investors

    What a Fully Depleted Social Security Fund REALLY Means for Your Retirement

    5 High Dividend Stocks to Beat Inflation (and Boost Retirement Income)

    11 Considerations for the 2025 Shutdown vs. Prior Shutdowns

    Crypto & Wall Street: Get Ready for a Flood of Alt-Coin ETFs?

    The Federal Reserve’s Rate-Cut Game Could Be Slow to Take Effect

    The Time Has Arrived: MSNBC Needs to be Closed Forever!

    Identifying the Three Types of Bear Markets – It Matters Which Type!

  • AI
    Micron Analysts Raise Their Price Targets to the Moon

    Micron Analysts Raise Their Price Targets to the Moon

    11 Stocks & Funds That Already Own SpaceX Shares Pre-IPO

    11 Stocks & Funds That Already Own SpaceX Shares Pre-IPO

    Did Apple’s AI Reboot Just Hamstring Long-Term Investors All Over Again?

    Did Apple’s AI Reboot Just Hamstring Long-Term Investors All Over Again?

    Did the Bubble Just Burst for Chips, AI, Quantum, Crypto?

    Why ‘Underappreciated’ & ‘Mispriced’ Zeta Stock Could Rise 30%

No Result
View All Result
  • Investing
    AOL Is Back (and Public Again)!

    AOL Is Back (and Public Again)!

    Are 13% Dividend Yields in Mortgage REITs Safe for Retirees?

    Are AT&T and Verizon Signaling Dividend Mortality?

    BofA Sees 4 Stocks to Sell Immediately!

    Wall Street’s Worry: Will Nike’s Turnaround Ever Make the Turn?

    Micron Analysts Raise Their Price Targets to the Moon

    Micron Analysts Raise Their Price Targets to the Moon

    4 Value Stocks That Could Rally 50% Into 2027

    Why Wall Street Finally Likes Target Again!

    Why Wall Street Finally Likes Target Again!

    11 Stocks & Funds That Already Own SpaceX Shares Pre-IPO

    SpaceX Options & Leveraged ETF Conundrum: The Tail Can Wag the Dog!

  • Economy

    Will the Fed Dare Hike Rates This Much? Or Even Worse?

    Why Gold & Silver Keep Crashing (& When It Stops!)

    Trump’s H-1B Visa Plan Gets Tossed; Math & Stats Need a Deeper Dive

    The $25 Minimum Wage Bill: A Path to Even More Drastic Inflation

    The U.S. Sovereign Wealth Fund That Could Be (and What It Could Have Been!)

    Wall Street’s 2026 S&P 500 Forecast Sees 11% Gains!

    Why Goldman Sachs Sees 2026 as Prime Time for Strategic investors

    THE TOP INVESTING THEMES OF 2026… According to A.I.

    Strategic to Secular: Bold 10-Year Goldilocks Outlook for Stocks from Goldman Sachs

  • Personal Finance
    AOL Is Back (and Public Again)!

    AOL Is Back (and Public Again)!

    Will the Fed Dare Hike Rates This Much? Or Even Worse?

    Why Gold & Silver Keep Crashing (& When It Stops!)

    Timeless Warren Buffett Lessons for Long-Term Investors

    What a Fully Depleted Social Security Fund REALLY Means for Your Retirement

    Trump’s H-1B Visa Plan Gets Tossed; Math & Stats Need a Deeper Dive

    The $25 Minimum Wage Bill: A Path to Even More Drastic Inflation

    8 Strategic stocks to Buy for Strong Gains in 2026

    Financial Giant Sees Path to $6,000 Gold, and Maybe $4,000+ Equilibrium

  • Retirement

    Are 13% Dividend Yields in Mortgage REITs Safe for Retirees?

    Timeless Warren Buffett Lessons for Long-Term Investors

    What a Fully Depleted Social Security Fund REALLY Means for Your Retirement

    5 High Dividend Stocks to Beat Inflation (and Boost Retirement Income)

    11 Considerations for the 2025 Shutdown vs. Prior Shutdowns

    Crypto & Wall Street: Get Ready for a Flood of Alt-Coin ETFs?

    The Federal Reserve’s Rate-Cut Game Could Be Slow to Take Effect

    The Time Has Arrived: MSNBC Needs to be Closed Forever!

    Identifying the Three Types of Bear Markets – It Matters Which Type!

  • AI
    Micron Analysts Raise Their Price Targets to the Moon

    Micron Analysts Raise Their Price Targets to the Moon

    11 Stocks & Funds That Already Own SpaceX Shares Pre-IPO

    11 Stocks & Funds That Already Own SpaceX Shares Pre-IPO

    Did Apple’s AI Reboot Just Hamstring Long-Term Investors All Over Again?

    Did Apple’s AI Reboot Just Hamstring Long-Term Investors All Over Again?

    Did the Bubble Just Burst for Chips, AI, Quantum, Crypto?

    Why ‘Underappreciated’ & ‘Mispriced’ Zeta Stock Could Rise 30%

No Result
View All Result
Oggonomics
No Result
View All Result
Home Investing

15 Stocks Analysts Want Investors to Sell Now!

Jon Ogg by Jon Ogg
September 20, 2025
in Investing
0
0
SHARES
0
VIEWS
Share on FacebookShare on Twitter

The U.S. Federal Reserve is (finally!) back in into an interest rate cutting environment. The S&P 500 is at 6,664.36 and up against an all-time high with gains of 1% in the last week and 13% year-to-date. Should investors take their profits or let those gains ride deeper into a bull market? The answer will, of course, depend upon whom you ask. It turns out that more than 50% of all analyst ratings are Buy/Outperform and generally less than 10% (maybe only 5%) of analyst calls are actual “Sell” and “Underperform” ratings.

What if those “Sell” equivalent ratings are right after such strong gains? Oggonomics has tracked many stocks analysts want their clients buying as the market continues to rage. There is also another group of stocks — there were 15 well-known stocks that Wall Street analysts are telling their clients to sell out of now. These come with formal “Sell” ratings or an “Underperform” rating. And some of their price targets on those sell ratings are lower than the current share price.

Oggonomics always reminds investors that no single analyst report should ever be the sole basis to buy or sell a stock. Analysts can get their thesis wrong just like the rest of us. And sometimes the market, or a company’s fundamentals, can change in the blink of an eye. Please read the disclaimer at the end of this reporting to read about additional investing risks.

Please note that all ratings and price targets referenced below have been assigned to each brokerage firm by name. Oggonomics maintains no formal rating of its own nor does it maintain any formal price targets on any of these shares.

Here are 15 fresh analyst calls from the week of September 15-19. 2025 where analysts are telling their clients to sell out of.

APA Corp. (NYSE: APA) was reiterated as Underperform at Mizuho on 9/15, with the firm trimming the price target down to $18 from $19 in its call. APA was already down about 7% as the oil and gas exploration outfit is now substantially above its lows. It was at $23.50 late on Friday with a 52-week range of $13.58 to $27.48.

Beyond Meat (NASDAQ: BYND) was going to change how protein was consumed with vegetarian meat-alternatives. That was then. Now it is just a $2.83 stock, with a 52-week range of $2.22 to $7.60 and a market cap oof barely $200 million. Beyond Meat was downgraded to Sell from Hold at Argus on 9/15, with the independent research firm issuing no price target but laser-focused on its current challenges, slowing sales and its weak balance sheet.

Camden Property Trust (NYSE: CPT) was downgraded to Sell from Neutral and its price target was cut to $106 from $118 at Goldman Sachs on 9/17. The apartment property owner and operator has roughly 60,000 U.S. apartment homes for rent in the U.S. Its stock was at $108.22 late on Friday, with a 52-week range of $102.35 to $127.69 and nearly a 3.9% dividend yield.

Cracker Barrel Old Country Store Inc. (NASDAQ: CBRL) had a rough week after earnings, and its rebrand didn’t help matters ahead of the earnings report. Cracker Barrel was reiterated as Underperform and its price objective was cut to $42 from $48 at BofA Securities on 9/18. Citi also maintained its Sell rating and cut its target to $42 from $47 on 9/18. Its shares were down at $43.75 before Friday’s close for a loss of about 15% for the week.

CVR Energy, Inc. (NYSE: CVI) is an interesting call because the stock was up about 78% year-to-date. CVE Energy was downgraded to Underperform from Neutral at Mizuho on 9/15, although its price target was raised to $29 from $27 in that same call. The refining outfit for refining and marketing of petroleum, renewables and nitrogen fertilizer was trading closer to $34.00 shortly before Friday’s closing bell. Interestingly enough, its shares hit a new year high on Friday as the 52-week range is now $15.10 to $34.15.

ALSO READ: GET READY FOR A WAVE OF ALT-COIN ETFs!!!

Deckers Outdoor Corporation NYSE: DECK) was initiated as Underperform with a $100 price target at Bernstein on 9/18. Its price late on Friday was $114.45 and its 52-week range is $93.72 to $223.98.

General Mills, Inc. (NYSE: GIS) was last seen down 20% as the packaged foods maker has had a bad 2025. The company said organic sales were down 3% its last quarter. General Mills was reiterated as Sell at UBS, with a price target cut to $47 from $49, on 9/18. The stock was at $50.35 late on Friday and its 52-week range is $48.29 to $75.33, with a dividend yield of 4.8% at the current time.

Healthcare Realty Trust (NYSE: HR) was downgraded to Underperform from Market Perform at Raymond James on 9/15. Healthcare Realty was at $18.20 late on Friday and its 52-week range is $14.09 to $18.82. Its dividend yield is currently 5.3%.

Intel Corporation (NASDAQ: INTC) saw a very mixed bag of analyst calls after its previously unexpected NVIDIA investment was in the news this week. Intel had popped 22% on Thursday and hit a 52-week high of $32.38 on the same day, but on Friday’s late-day trading it was at $29.60.

Lincoln National Corp. (NYSE: LNC) was initiated as Underperform with a $37 price target at Wolfe Research on 9/16. Lincoln National was trading up 3.4% at $41.15 late on Friday — after Morgan Stanley raised its rating to Overweight with a much stronger $58 target. Only one of these calls on the life insurance provider will prove to be correct in the months ahead, right?

Lyft Inc. (NASDAQ: LYFT) has had a strong 2025 with a gain of about 75% YTD, but not everyone is optimistic. Lyft was reiterated with an Underperform rating at BofA Securities on 9/18, although its price objective was raised to $14 from $12 in that call. Other firms such as Deutsche Bank, Canaccord Genuity and Jefferies have the equivalent of “Hold” ratings and they raised their price targets this week as a counterbalance to the BofA views.

Molson Coors Beverage Co. (NYSE: TAP) was downgraded to Underperform from Equal-Weight at Barclays on 9/15. While the price target was nudged higher to $50 from $49, this stock was at $48.42 ahead of the call. Molson Coors closed out the week at $46.57. 

National Storage Affiliates (NSE: NSA) was maintained as Underperform by Evercore ISI Group, and other firms trimmed their targets as well. National Storage closed down 2.3% at $29.90 on Friday and was above $31 a week earlier. It also sports a dividend yield above 7%.

PBF Energy Inc. (NYSE: PBF) was maintained with an Underperform rating at Mizuho on 9/15. While the firm raised its price target to $26 from $23 in the call, PBF Energy closed out the week at $30.13. Please note that this stock closed up nearly 10% in this last week and the $3.5 billion oil and gas exploration outfit is up 13% YTD. 

Target Corporation (NYSE: TGT) continues to face pressure in 2025. It was down 2% for the last week and is now down 34% year-to-date and down 42% from this time a year ago. Target was initiated as Underperform with a $80 price target at Wolfe Research on 9/18. The stock was at $88.93 ahead of this “sell” rating and it implies roughly 10% more downside based on current prices (if the analyst is correct. Target now has an ‘accidentally high dividend yield of over 5% due to its dividend maintenance as share prices have come down. And if an $88 or $80 share price isn’t bad enough for the recent performance, Target’s stock was $260 back in 2021.

Tags: analyst downgradesAPABYNDCBRLCPTCVIDECKGISHRINTCLNCLYFTNSAPBFTAPTGT
Previous Post

Intel Analysts’ Strategic Changes After NVIDIA Are Surprising

Next Post

Strategically Speaking: Have Investors Missed the Secular Rare Earths Train?

Jon Ogg

Jon Ogg

Related Posts

AOL Is Back (and Public Again)!
Investing

AOL Is Back (and Public Again)!

by Jon Ogg
July 2, 2026
Investing

Are 13% Dividend Yields in Mortgage REITs Safe for Retirees?

by Jon Ogg
July 1, 2026
Investing

Are AT&T and Verizon Signaling Dividend Mortality?

by Jon Ogg
July 1, 2026
Investing

BofA Sees 4 Stocks to Sell Immediately!

by Jon Ogg
June 29, 2026
Investing

Wall Street’s Worry: Will Nike’s Turnaround Ever Make the Turn?

by Jon Ogg
June 26, 2026
Next Post

Strategically Speaking: Have Investors Missed the Secular Rare Earths Train?

Premium Content

Why BofA Sees Tough 2025 Setup for Homebuilders

January 27, 2025

Your 4% Treasury Bond Window is Closing Fast: Debt, Rate Cuts, Dividends, Deficits

August 22, 2024

Top Analyst Upgrades & Downgrades: Apple, Amazon, Caterpillar, FedEx, Home Depot, Rivian, Robinhood & More

June 26, 2024

Browse by Category

  • AI
  • Economy
  • General
  • Investing
  • Personal Finance
  • Retirement
  • Uncategorized

Oggonomics Newsletter

Subscribe to our weekly newsletter.

Enter your email address

Browse by Tags

AAPL AI AMD AMZN analyst downgrades analyst upgrades AVGO BA BAC bitcoin Bonds China CMG CRM CRWD dividends DLTR ETFs Federal Reserve GEV GLD GM gold GOOG GOOGL GS INTC IPO JPM mergers META MSFT MSTR MU NFLX NKE NVDA PLTR SBUX SPY T Trump TSLA UNH WMT
Oggonomics

Oggonomics delivers daily stock analysis, Wall Street analyst coverage, and no-nonsense market commentary for investors who think for themselves.

Learn more

Pages

Home
About

Categories

  • AI
  • Economy
  • General
  • Investing
  • Personal Finance
  • Retirement
  • Uncategorized

Recent Posts

  • AOL Is Back (and Public Again)!
  • Are 13% Dividend Yields in Mortgage REITs Safe for Retirees?
  • Are AT&T and Verizon Signaling Dividend Mortality?

© 2026 JNews - Premium WordPress news & magazine theme by Jegtheme.

Welcome Back!

Login to your account below

Forgotten Password?

Retrieve your password

Please enter your username or email address to reset your password.

Log In
No Result
View All Result
  • Home
  • Landing Page
  • Buy JNews
  • Support Forum
  • Contact Us

© 2026 JNews - Premium WordPress news & magazine theme by Jegtheme.

Oggonomics Newsletter

Subscribe to our weekly newsletter below and keep up with Oggonomics articles.

Enter your email address

Thanks, I’m not interested